NADSYN1 Rabbit Polyclonal Antibody

SKU: orb326642

Description

Rabbit polyclonal antibody to NADSYN1

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NADSYN1
• Target: NADSYN1
• Protein Sequence: Synthetic peptide located within the following region: PAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDG
• Molecular Weight: 78kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ10631 antibody, anti FLJ36703 antibody, anti FLJ40627 antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.

Positive control (+): MCF7 Cell Lysate (N10), Negative control (-): HepG2 Cell Lysate (HG), Antibody concentration: 3 ug/mL.

Quick Database Links

Gene Symbol

NADSYN1

UniProt

Q6IA69

RefSeq (Protein):NP_060631