Myosin regulatory light chain 2 Antibody (Phospho-Ser18)

• Catalog Number: orb2240612
• Category: Antibodies
• Description: Myosin regulatory light chain 2 Antibody (Phospho-Ser18)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC, IHC-P, WB
• Isotype: IgG
• Immunogen: The antiserum was produced against synthesized peptide derived from human Myosin regulatory light chain 2 around the phosphorylation site of Ser18.
• Form/Appearance: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Conjugation: Unconjugated
• MW: 19 kDa
• UniProt ID: P24844
• Protein Sequence: Synthetic peptide located within the following region: SKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKE
• Storage: -20°C
• Buffer/Preservatives: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Alternative names: 20 kDa myosin light chain;CD124;epididymis secreto
• Note: For research use only
• Application notes: Application Info: WB: 1:500~1000IHC: 1:50~100IF: 1:100~500ELISA: 1:20000
• Expiration Date: 12 months from date of receipt.