Cart summary

You have no items in your shopping cart.

    Myosin regulatory light chain 2 Antibody (Phospho-Ser18) : FITC

    Myosin regulatory light chain 2 Antibody (Phospho-Ser18) : FITC

    Catalog Number: orb2071437

    DispatchUsually dispatched within 5-10 working days
    $ 578.00
    Catalog Numberorb2071437
    CategoryAntibodies
    DescriptionMyosin regulatory light chain 2 Antibody (Phospho-Ser18) : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsELISA, IF, IHC, WB
    ImmunogenThe antiserum was produced against synthesized peptide derived from human Myosin regulatory light chain 2 around the phosphorylation site of Ser18.
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW19 kDa
    UniProt IDP24844
    Protein SequenceSynthetic peptide located within the following region: SKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKE
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesCD124, IL4RA, IL-4RA
    Read more...
    NoteFor research use only
    Application notesApplication Info: WB: 1:500~1:1000IHC: 1:50~1:100IF: 1:100~1:500ELISA: 1:20000
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars