MYLPF Rabbit Polyclonal Antibody

• Catalog Number: orb586444
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MYLPF
• Target: MYLPF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYLPF
• Protein Sequence: Synthetic peptide located within the following region: LEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
• UniProt ID: Q96A32
• MW: 19 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DA1C, MLC2B, MRLC2, MYL11, HUMMLC2B
• Note: For research use only
• NCBI: NP_037424

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The protein may be modified by phosphorylation.

WB Suggested Anti-MYLPF Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell.