You have no items in your shopping cart.
Cart summary
Item 1 of 1
MYL12B Rabbit Polyclonal Antibody
Catalog Number: orb587197
| Catalog Number | orb587197 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MYL12B |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human MYL12B |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 20kDa |
| Target | MYL12B |
| UniProt ID | O14950 |
| Protein Sequence | Synthetic peptide located within the following region: EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDE |
| NCBI | NP_291024 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | MLC-B, MRLC2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: ACHN Whole cell lysates, Antibody dilution: 1.0 ug/ml. MYL12B is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.
- Item 1 of 4
MLC-2 (phospho Thr17/S18) rabbit pAb [orb767400]
ELISA, IHC-P
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
- Item 1 of 2
MYL12B Antibody [orb629088]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
- Item 1 of 1
