MYH9 monoclonal antibody (M06), clone 4H3

• Catalog Number: orb2292549
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MYH9.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 4H3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002464.1

Detection limit for recombinant GST tagged MYH9 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MYH9 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human ovarian cancer. [antibody concentration 0.7 ug/ml]

Western Blot detection against Immunogen (35.64 KDa).