MYH9 monoclonal antibody (M01), clone 3C7

• Catalog Number: orb2292551
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MYH9.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C7
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse
• Isotype: IgG2b Kappa
• Immunogen: MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE
• NCBI: NP_002464.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged MYH9 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to MYH9 on A-431 cell. [antibody concentration 10 ug/ml]

MYH9 monoclonal antibody (M01), clone 3C7 Western Blot analysis of MYH9 expression in A-431.

MYH9 monoclonal antibody (M01), clone 3C7. Western Blot analysis of MYH9 expression in NIH/3T3.

Western Blot detection against Immunogen (35.64 KDa).