MUS81 Rabbit Polyclonal Antibody

• Catalog Number: orb331131
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MUS81
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Mouse, Porcine, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: MUS81
• UniProt ID: Q96NY9
• Protein Sequence: Synthetic peptide located within the following region: GETRGGGHRPELLRELQRLHVTHTVRKLHVGDFVWVAQETNPRDPANPGE
• NCBI: NP_079404
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ21012 antibody, anti FLJ44872 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 20 ug 293T cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: MUS81.

WB Suggested Anti-MUS81 Antibody, Titration: 1.0 ug/ml, Positive Control: A549 Whole Cell.