You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976937 |
---|---|
Category | Proteins |
Description | Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.; Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. Mumps virus (strain Miyahara vaccine) Hemagglutinin-neuraminidase Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.0 kDa and the accession number is P11235. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | YATHDFSIGHPLNMPSFIPTATSPNGCTRIPSFSLGKTHWCYTHNVINANCKDHTSSNQYISMGILVQTASGYPMFKTLKIQYLSDGLNRKSCSIATVPDGCAMYCYVSTQLETDDYAGSSPPTQKLTLLFYNDTVTERTISPTGLEGNWATLVPGVGSGIYFENKLIFPAYGGVLPNSSLGVKSAREFFRPVNPYNPCSGPQQDLDQR |
UniProt ID | P11235 |
MW | 27.0 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | MuV |
Biological Activity | Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion.; Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. Mumps virus (strain Miyahara vaccine) Hemagglutinin-neuraminidase Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 27.0 kDa and the accession number is P11235. |
Expression Region | 152-360 aa |
Storage | -20°C |
Note | For research use only |