You have no items in your shopping cart.
Page Not Found
Cart summary
MT2A Protein, Human, Recombinant (His)
Catalog Number: orb1978247
| Catalog Number | orb1978247 |
|---|---|
| Category | Proteins |
| Description | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 7.9 kDa (predicted) |
| UniProt ID | P02795 |
| Protein Sequence | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
| Expression Region | 1-59 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
