MSX1 Rabbit Polyclonal Antibody

• Catalog Number: orb329601
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MSX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MSX1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 31kDa
• Target: MSX1
• UniProt ID: P28360
• Protein Sequence: Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
• NCBI: NP_002439
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti HOX7 antibody, anti HYD1 antibody, anti STHAG
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HumanMuscle

WB Suggested Anti-MSX1 Antibody Titration: 2.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Kidney.