MSTO1 Rabbit Polyclonal Antibody

SKU: orb330149

Description

MSTO1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MSTO1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human MSTO1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MSTO1
• Target: MSTO1
• Protein Sequence: Synthetic peptide located within the following region: YRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGK
• Molecular Weight: 62kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686B1757 antibody, anti DKFZp686I01261 antibody, anti FLJ10504 antibody, anti LST005 antibody, anti MST antibody, anti RP11-29H23.3 antibody

WB Suggested Anti-MSTO1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

MSTO1

UniProt

Q9BUK6

RefSeq (Protein):NP_060586