MSRB2 monoclonal antibody (M01), clone 2B7

• Catalog Number: orb2291381
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant MSRB2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: MSRB2 (NP_036360, 102 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
• Tested applications: ELISA, WB
• Clone Number: 2B7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_036360

Detection limit for recombinant GST tagged MSRB2 is approximately 0.3 ng/ml as a capture antibody.

Western Blot analysis of MSRB2 expression in transfected 293T cell line by MSRB2 monoclonal antibody (M01), clone 2B7. Lane 1: MSRB2 transfected lysate (Predicted MW: 11.11 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).