MSLN Rabbit Polyclonal Antibody

SKU: orb578406

Description

MSLN Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MSLN. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human MSLN. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Porcine, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Disease Biomarkers, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MSLN
• Target: MSLN
• Protein Sequence: Synthetic peptide located within the following region: QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL
• Molecular Weight: 69 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MPF, SMRP

Quick Database Links

Gene Symbol

MSLN

UniProt

Q13421

RefSeq (Protein):NP_005814