MSH5 Rabbit Polyclonal Antibody

• Catalog Number: orb330177
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MSH5
• Target: MSH5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MSH5
• Protein Sequence: Synthetic peptide located within the following region: KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI
• UniProt ID: Q9UMP2
• MW: 95kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DKFZp434C1615 antibody, anti G7 antibody, ant
• Note: For research use only
• NCBI: NP_079535

WB Suggested Anti-MSH5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 721_B cell lysate, MSH5 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.