C9orf30 Rabbit Polyclonal Antibody

• Catalog Number: orb585536
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C9orf30
• Target: MSANTD3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: LSTHVLGKEKIASMLPEQLYFLQSPPEEEPEYHPDASAQESFAVSNRELC
• UniProt ID: Q96H12
• MW: 30kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: L8, C9orf30
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_542386

Rabbit Anti-MSANTD3 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Lung, Respiratory Epithelium, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-C9orf30 Antibody, Titration: 1.0 ug/ml, Positive Control: HT1080 Whole Cell.