MRPS18C Rabbit Polyclonal Antibody

• Catalog Number: orb587544
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MRPS18C
• Target: MRPS18C
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS18C
• Protein Sequence: Synthetic peptide located within the following region: FVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKD
• UniProt ID: Q9Y3D5
• MW: 15kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CGI-134, S18mt-c, MRPS18-1, mrps18-c, MRP-S18-1, M
• Note: For research use only
• NCBI: NP_057151

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.