MRPS15 Rabbit Polyclonal Antibody

• Catalog Number: orb577228
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MRPS15
• Target: MRPS15
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MRPS15
• Protein Sequence: Synthetic peptide located within the following region: RRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIP
• UniProt ID: P82914
• MW: 30kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DC37, S15mt, RPMS15, MPR-S15
• Research Area: Epigenetics & Chromatin, Molecular Biology, Signal
• Note: For research use only
• NCBI: NP_112570

WB Suggested Anti-MRPS15 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. MRPS15 is supported by BioGPS gene expression data to be expressed in 721_B.