MRPS12 Rabbit Polyclonal Antibody

• Catalog Number: orb579743
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MRPS12
• Target: MRPS12
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS12
• Protein Sequence: Synthetic peptide located within the following region: LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK
• UniProt ID: O15235
• MW: 12kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RPS12, RPMS12, RPSM12, MPR-S12, MT-RPS12
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_066930
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-MRPS12 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.