You have no items in your shopping cart.
Cart summary
Item 1 of 1
MRGPRX3 Rabbit Polyclonal Antibody
Catalog Number: orb584510
| Catalog Number | orb584510 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to MRGPRX3 |
| Target | MRGPRX3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MRGPRX3 |
| Protein Sequence | Synthetic peptide located within the following region: LDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQR |
| UniProt ID | Q96LA9 |
| MW | 36kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | GPCR, MRGX3, SNSR1, SNSR2 |
| Note | For research use only |
| NCBI | NP_473372 |
WB Suggested Anti-MRGPRX3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.
- Item 1 of 4
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
MRGX3 Rabbit Polyclonal Antibody [orb185236]
IF, IHC-Fr, IHC-P
Human
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl
