You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295256 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human MPPED1 protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | MPPED1 (NP_001576.3, 1 a.a. ~ 326 a.a) full-length human protein. |
Protein Sequence | MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS |
Tested applications | IHC-P, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001576.3 |
Immunoperoxidase of purified MaxPab antibody to MPPED1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml].
MPPED1 MaxPab polyclonal antibody. Western Blot analysis of MPPED1 expression in rat brain.
Western Blot analysis of MPPED1 expression in transfected 293T cell line by MPPED1 MaxPab polyclonal antibody. Lane 1: MPPED1 transfected lysate(35.86 KDa). Lane 2: Non-transfected lysate.