You have no items in your shopping cart.
MPG Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MPG |
| Target | MPG |
| Protein Sequence | Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA |
| Molecular Weight | 32kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−MPG Rabbit Polyclonal Antibody [orb633109]
ELISA, IHC, WB
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgMPG Rabbit Polyclonal Antibody [orb628899]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgMPEG1/Macrophage Specific Gene Rabbit Polyclonal Antibody (FITC) [orb188591]
ICC, IF
Human, Mouse, Rat
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

MPG was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579254 with 1:200 dilution. Western blot was performed using orb579254 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: MPG IP with orb579254 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

WB Suggested Anti-MPG Antibody, Positive Control: Lane 1: 50 ug RCC4 lysate, Lane 2: 50 ug RCC4 lysate, Lane 3: 50 ug 786-0 lysate, Lane 4: 50 ug 786-0 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-Alexa 680, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-MPG Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.
Quick Database Links
UniProt Details
−NCBI Reference Sequences
−| Protein | NP_001015052 |
|---|
Documents Download
Request a Document
MPG Rabbit Polyclonal Antibody (orb579254)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review





