You have no items in your shopping cart.
Mouse Serpina3n protein
SKU: orb605049
Featured
Description
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 60.8 kDa |
| Expression Region | 21-418aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Serpina3n, Spi2, Serine protease inhibitor A3N, Serpin A3N
Similar Products
−
Recombinant Mouse a1ACT/Serpina3n Protein, N-His [orb2964425]
>90% as determined by SDS-PAGE.
29.15 kDa
1 mg, 100 μg, 50 μg- Item 1 of 1
Mouse Serpina3n protein [orb605518]
Greater than 85% as determined by SDS-PAGE.
47.3 kDa
Yeast
20 μg, 1 mg, 100 μg - Item 1 of 1
Mouse Serpina3n protein [orb605517]
Greater than 90% as determined by SDS-PAGE.
46.8 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Mouse Serpina3n protein [orb605281]
Greater than 85% as determined by SDS-PAGE.
48.3 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Mouse Serpina3n protein [orb246598]
Greater than 85% as determined by SDS-PAGE.
60.8 kDa
E.coli
100 μg, 1 mg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Serpina3n.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Serpina3n protein (orb605049)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks