Mouse S100A8 protein

SKU: orb418741

Description

This Mouse S100A8 protein spans the amino acid sequence from region 2-89aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 2-89aaSequence Info: Full Length

Key Properties

• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 2-89aa
• Protein Length: Full Length of Mature Protein
• MW: 26.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8 , MRP-8 , p8Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8

Quick Database Links

UniProt

P27005