Item 1 of 1

Mouse Msln protein

Catalog Number: orb244390

Catalog Number	orb244390
Category	Proteins
Description	Recombinant mouse Mesothelin
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
Protein Length	Partial
UniProt ID	Q61468
MW	50.1 kDa
Application notes	Mesothelin, cleaved form of His-SUMO-tag and expression region is 298-600aa
Endotoxins	Not test.
Source	E.coli
Biological Origin	Mus musculus (Mouse)
Expression Region	298-600aa
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative names	Msln
Note	For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Item 1 of 4

Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 59.3 kDa after removal of the signal peptide.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Purity:	> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
MW:	Due to glycosylation, the protein migrates to 45-60 kDa based on Tris-Bis PAGE result.

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	36.1 kDa
Source:	Yeast