You have no items in your shopping cart.
Mouse Mcl1 protein
SKU: orb244367
Featured
Description
Research Area
Apoptotic, Cancer, Developmental Biology, Epigenetics, Neuroscience, Signaling Pathways
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Molecular Weight | 48.9 kDa |
| Expression Region | 1-308aa |
| Protein Length | Partial |
| Protein Sequence | MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Mcl1
Similar Products
−- Item 1 of 1
Mouse Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1) ELISA Kit [orb780844]
Mouse
0.16-10 ng/mL
0.062 ng/mL
96 T, 48 T - Item 1 of 2
MCL1 Rabbit Monoclonal Antibody [orb547445]
FC, ICC, IF, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Monoclonal
Unconjugated
100 μl 
Mcl1 (NM_008562) Mouse Recombinant Protein [orb3041398]
> 80% as determined by SDS-PAGE and Coomassie blue staining
35.7 kDa
100 μg, 1 mg, 20 μg
Mouse MCL1(Myeloid Cell Leukemia Sequence 1, Bcl2 Related) Microsample ELISA Kit [orb2997715]
Mouse
0.16-10 ng/mL
0.065 ng/mL
48 T, 96 TMouse Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1 (MCL1) ELISA Kit [orb2809816]
Mouse
0.156-10ng/mL
0.071ng/mL
5 x 96 T, 48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mcl1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Mcl1.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Mcl1 protein (orb244367)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks