You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Il2rb protein
Catalog Number: orb245886
| Catalog Number | orb245886 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Interleukin-2 receptor subunit beta |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
| Protein Length | Partial |
| UniProt ID | P16297 |
| MW | 27.1 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 27-240aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Il2rb |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Mouse l2rb protein [orb604191]
Greater than 90% as determined by SDS-PAGE.
29.3 kDa
E.coli
100 μg, 20 μg, 1 mg 
Mouse IL2RB Protein, His Tag [orb2698956]
> 90%, determined by SDS-PAGE
This protein contains the mouse IL2RB (P16297) (Met1-Glu240) was expressed with a C-terminal polyhistidine tag and expressed from HEK293 Cells.
10 μg, 5 μg
