You have no items in your shopping cart.
Cart summary
Mouse Il2rb protein
Catalog Number: orb245886
| Catalog Number | orb245886 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Interleukin-2 receptor subunit beta |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 27.1 kDa |
| UniProt ID | P16297 |
| Protein Sequence | AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE |
| Protein Length | Partial |
| Source | Yeast |
| Expression System | Expression Region: 27-240aa. Protein Length: Partial |
| Expression Region | 27-240aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Il2rb Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Mouse IL-15 R alpha / CD215 Protein [orb867324]
Unconjugated
90%
44.8 kDa
Mouse IL-15 R alpha, Fc Tag (orb867324) is expressed from human 293 cells (HEK293). It contains AA Gly 33 - Lys 205 (Accession # Q60819-1).
100 μg, 1 mg Mouse l2rb protein [orb604191]
Greater than 90% as determined by SDS-PAGE.
29.3 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars