Mouse Ifne protein

SKU: orb244873

Description

This Mouse Ifne protein spans the amino acid sequence from region 22-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology

Images & Validation

• Application Notes:
  This is His-SUMO-tag protein

Key Properties

• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 22-192aa
• Protein Length: Full Length of Mature Protein
• MW: 36 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Ifne

Quick Database Links

UniProt

Q80ZF2