Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Mouse Hba protein
Catalog Number orb245861
Species/HostMouse
ConjugationUnconjugated
Target Hba
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
Purity >90% as determined by SDS-PAGE.
MW 17 kDa
Source Yeast
Uniprot ID P01942
Product Description

Recombinant mouse Hemoglobin subunit alpha

Application Notes
Application Notes This is His-tag protein
Reviews
Write Your Own Review
You're reviewing:Mouse Hba protein - orb245861
Your Rating