Mouse GP73 protein

SKU: orb383325

Description

This Mouse GP73 protein spans the amino acid sequence from region 36-393aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Key Properties

• Source: E.coli
• Biological Origin: Mus musculus (Mouse)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 36-393aa
• Protein Length: Partial
• MW: 56.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEFQGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAVLVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQFQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIEEVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEEVPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQVQNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEKLDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQQRASEEGGGQKNPGDEYDMDENEAESEREKQAALAGNDRNINVLNADAQKRGIINVPVGSERQSHILNQVGIHIPQQA

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti Golgi membrane protein 1protein, anti Golgi membrane protein GP73protein, anti Golgi phosphoprotein 2protein, anti Golgi protein 73 kDprotein, anti golgi protein 73kDprotein, anti GOLM 1protein, anti GOLM1protein, anti GOLPH 2protein, anti GOLPH2protein, anti GP 73protein, anti GP73protein

Quick Database Links

UniProt

Q91XA2