You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Gcgr protein
Catalog Number: orb244222
| Catalog Number | orb244222 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Glucagon receptor |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ |
| Protein Length | Partial |
| UniProt ID | Q61606 |
| MW | 40.8 kDa |
| Application notes | Extracellular domain of GST-tag and expression region is 27-143aa |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 27-143aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Gcgr |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse Gcgr protein [orb245845]
Greater than 90% as determined by SDS-PAGE.
15.8 kDa
Yeast
1 mg, 20 μg, 100 μg 
Recombinant Mouse GCGR Protein, C-Fc [orb2831552]
> 90% as determined by SDS-PAGE.
42.91 kDa
100 μg, 50 μg, 20 μg
