Mouse Fgf1 protein

Catalog Number: orb594769

Catalog Number	orb594769
Category	Proteins
Description	Recombinant Mouse Fibroblast growth factor 1(Fgf1) (Active)
Reactivity	Mouse
Tag	Tag-Free
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	15.7 kDa
UniProt ID	P61148
Protein Sequence	FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Protein Length	Full Length of Mature Protein
Source	E.coli
Biological Activity	The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of Heparin is less than 1.6 ng/mL.
Expression Region	16-155aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, pH 6.6
Alternative names	Fibroblast Growth Factor 1; FGF-1; Acidic Fibrobla Read more...
Note	For research use only
Application notes	Full Length of Mature Protein
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1629, Recombinant Mouse FGF1/FGFa/FGF acidic Protein is produced by E. coli expression system. The target protein is expressed with sequence (Phe16-Asp155) of mouse FGF1/FGFa/FGF acidic (Accession #P61148).

Sizes Available: 50 μg, 500 μg

Recombinant Mouse FGF-1/Fgf1 Protein, His Tag [orb1552410]
Purity:
≥90% as determined by SDS-PAGE
Source:
This protein contains the mouse Fgf1(Phe16-Asp155) was fused with the C-terminal His Tag and expressed in E. coli.
Sizes Available: 100 μg, 50 μg
Mouse FGF acidic protein [orb49774]
Source:
E.coli
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	19.8 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Fgf1(Phe16-Asp155) was fused with the C-terminal His Tag and expressed in E. coli.