You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Esm1 protein
Catalog Number: orb358853
| Catalog Number | orb358853 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Esm1 protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q9QYY7 |
| MW | 33.7 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 22-184aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Short name, ESM-1 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Mouse ESM1 protein [orb707191]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μg- Item 1 of 1
- Item 1 of 1
ESM1 Mouse Monoclonal Antibody [orb1816988]
WB
Mouse, Rat
Human
Mouse
Monoclonal
Unconjugated
200 μg, 50 μl, 100 μl, 200 μl ESM1 Protein, Mouse, Recombinant (His) [orb1956471]
98.00%
19.17 kDa (predicted); 23 kDa (reducing conditions)
50 μgMouse ESM1 Protein, His Tag [orb2698800]
> 95%, determined by SDS-PAGE
This protein contains the mouse TLR2 (Q9QYY7) (Met1-Arg184) was fused with a polyhistidine tag at the C-terminus and expressed from Baculovirus-Insect Cells.
50 μg, 20 μg
