You have no items in your shopping cart.
Cart summary
Item 1 of 1
Mouse Efnb3 protein
Catalog Number: orb245817
| Catalog Number | orb245817 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mus musculus Ephrin-B3 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA |
| Protein Length | Extracellular Domain |
| UniProt ID | O35393 |
| MW | 24 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 28-227aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Efnb3 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Mouse Efnb3 protein [orb244175]
Greater than 90% as determined by SDS-PAGE.
26 kDa
E.coli
20 μg, 100 μg, 1 mg 
Mouse EFNB3 Protein, His Tag [orb2698773]
> 95%, determined by SDS-PAGE
This protein contains the mouse Efnb3 (NP_031937.1) (Met1-Ala227) was expressed with a polyhistidine tag at the C-terminus and expressed from HEK293 Cells.
100 μg, 50 μgMouse EFNB3 Protein, Fc Tag [orb2698774]
> 95%, determined by SDS-PAGE
This protein contains the mouse Efnb3 (NP_0319371) (Met1-Ala227) was expressed with the Fc region of human IgG1 at the C-terminus and expressed from HEK293 Cells.
100 μg, 50 μg
