Mouse ctss protein

Catalog Number: orb244147

Catalog Number	orb244147
Category	Proteins
Description	Recombinant mouse Cathepsin S
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	27.7 kDa
UniProt ID	O70370
Protein Sequence	LPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 123-340aa. Protein Length: Full Length of Mature Protein
Expression Region	123-340aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	ctss Read more...
Note	For research use only
Application notes	Full length of His-tag and expression region is 123-340aa
Expiration Date	6 months from date of receipt.

Mouse CTSS protein [orb707092]
Applications:
ELISA, MS, SDS-PAGE, WB
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
Source:
Human cells
Sizes Available: 500 μg, 50 μg, 10 μg
Recombinant Mouse Cathepsin-S/Ctss Protein, His Tag [orb1552751]
Purity:
≥90% as determined by SDS-PAGE
Source:
This protein contains the mouse Ctss(Val18-Ile340) was fused with the C-terminal His Tag and expressed in Mammalian cells.
Sizes Available: 100 μg, 50 μg
Mouse Cathepsin S protein [orb334354]
Source:
Human Cells
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg
Mouse CTSS Protein [orb424969]
Sizes Available: 1 mg, 10 μg, 2 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the mouse Ctss(Val18-Ile340) was fused with the C-terminal His Tag and expressed in Mammalian cells.