You have no items in your shopping cart.
Cart summary
Item 1 of 4
Item 1 of 4
Mouse Ces1c protein
Catalog Number: orb246077
| Catalog Number | orb246077 |
|---|---|
| Category | Proteins |
| Description | Recombinant mouse Carboxylesterase 1C |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 60.6 kDa |
| UniProt ID | P23953 |
| Protein Sequence | HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPPETDPTEH |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Mus musculus (Mouse) |
| Expression Region | 19-550aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Ces1c Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ces1c.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ces1c.
The purity of Ces1c was greater than 95% as determined by SEC-HPLC
- Item 1 of 1
Mouse CES1C protein [orb418954]
Greater than 90% as determined by SDS-PAGE.
58.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Ces1c protein [orb244700]
Greater than 90% as determined by SDS-PAGE.
85.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Mouse Ces1c Protein [orb1476825]
Greater than 90% as determined by SDS-PAGE.
63.6 kDa
Mammalian cell
1 mg, 20 μg, 100 μg 
CES1C Protein, Mouse, Recombinant (His & Myc) [orb1977358]
98.00%
63.6 kDa (predicted)
1 mg, 100 μg, 20 μg
