MORF4L1 Rabbit Polyclonal Antibody

SKU: orb574402

Description

Rabbit polyclonal antibody to MORF4L1

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MORF4L1
• Target: MORF4L1
• Protein Sequence: Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ
• Molecular Weight: 40kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15

Human Heart

Human urinary bladder

Rabbit Anti-MORF4L1 Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-MORF4L1 Antibody Titration: 5.0-10.0 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

MORF4L1

UniProt

Q86YT7