MORF4L1 Rabbit Polyclonal Antibody

• Catalog Number: orb574401
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MORF4L1
• Target: MORF4L1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MORF4L1
• Protein Sequence: Synthetic peptide located within the following region: KDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYA
• UniProt ID: A5D8W6
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORF
• Research Area: Epigenetics & Chromatin, Molecular Biology, Protei
• Note: For research use only
• NCBI: NP_006782

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. MORF4L1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.

WB Suggested Anti-MORF4L1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:500, Positive Control: Human Placenta.