Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 4-5 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Monkey LTB protein
Catalog Number orb418769
ReactivityMonkey
ConjugationUnconjugated
Sequence Extracellular Domain
Target LTB
Product Properties
Form/Appearance Lyophilized: Tris-based buffer, 50% glycerol
Storage Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°.
Tag N-terminal 6xHis-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRTPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG
Purity >90% as determined by SDS-PAGE.
MW 24.8 kDa
Source E.coli
Expression Region 49-244aa
Uniprot ID Q862Z7
Product Description

Recombinant Pan troglodytes Lymphotoxin-beta

Application Notes
Application Notes Tag Info: N-terminal 6xHis-tagged
Expression Region: 49-244aa
Sequence Info: Extracellular Domain
Reviews
Write Your Own Review
You're reviewing:Monkey LTB protein - orb418769
Your Rating