You have no items in your shopping cart.
Cart summary
Item 1 of 1
Monkey Il17a protein
Catalog Number: orb244300
| Catalog Number | orb244300 |
|---|---|
| Category | Proteins |
| Description | Recombinant monkey IL-17A protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 42.1 kDa |
| UniProt ID | F6T3G5 |
| Protein Sequence | GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Biological Origin | Macaca mulatta (Rhesus macaque) |
| Expression Region | 24-155aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Il17a Ctla8 Il17 Read more... |
| Note | For research use only |
| Application notes | Full length of GST-tag and expression region is 24-155aa |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Recombinant Cyn. monkey IL17A protein, C-His-Avi (HEK293) [orb1516413]
> 95% as determined by Tris-Bis PAGE
Due to glycosylation, the protein migrates to 26-32 kDa based on Tris-Bis PAGE result.
50 μg, 100 μg 
Rhesus Monkey IL17A & IL17F Protein, His Tag [orb2698042]
> (65.3+32.9)%, determined by SDS-PAGE
This protein contains the rhesus monkey IL17A (XP_0011063911) (Met 1 - Ala 155) and the mature form of rhesus monkey IL17F (NP_0012482161) (Arg 31 - Gln 163) linked by a polypeptide linker was expressed with a polyhistidine tag at the C-terminus and expressed from HEK293 Cells.
100 μg, 20 μg
