MMP25 Rabbit Polyclonal Antibody

• Catalog Number: orb586019
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MMP25
• Target: MMP25
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: FGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQ
• UniProt ID: Q9NPA2
• MW: 48kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MMP20, MMPL1, MMP-25, MMP20A, MT6MMP, MTMMP6, MT-M
• Research Area: Cancer Biology, Cell Biology, Stem Cell & Developm
• Note: For research use only
• NCBI: NP_071913

WB Suggested Anti-MMP25 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.