MMP13 Rabbit Polyclonal Antibody

SKU: orb583121

Description

Rabbit polyclonal antibody to MMP13

Research Area

Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Equine, Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMP13
• Target: MMP13
• Protein Sequence: Synthetic peptide located within the following region: HFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
• Molecular Weight: 42kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CLG3, MDST, MANDP1, MMP-13

Sample Type: 1. Normal HUman Cartilage (50 ug), 2. Human Osteoarthritis cartilage (50 ug), 3. Human Osteoarthritis chondrocytes (50 ug), 4. Human Osteoarthritis chondrocytes +IL-1 (50 ug), Primary dilution: 1:2000, Secondary Antibody: HRP conjugated anti-rabbit, Secondary dilution: 1:5000.

Sample Type: Equine Cartilage Explants, Primary dilution: 1:1000, Secondary dilution: 1:100000.

WB Suggested Anti-MMP13 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

MMP13

UniProt

P45452

RefSeq (Protein):NP_002418