You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb389424 |
---|---|
Category | Antibodies |
Description | MMP13 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Monkey |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino aci |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Monkey |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 53820 MW |
UniProt ID | P45452 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Collagenase 3;3.4.24.-;Matrix metalloproteinase-13 Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of MMP13 using anti-MMP13 antibody.Lane 1:HELA cell.
WB analysis of MMP13 using anti-MMP13 antibody.Lane 1:human PC-3 cell;2:human U20S cell;3:human A549 cell;4:human HEK293 cell.5:Rabbit IgG(55KD);6:Marker 11137:human MDA-MB-453 cell;8:monkey COS-7 cell;9:rat lung tissue;10:mouse lung tissue.
ELISA, IF, IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating