MMP1 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2292588
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human MMP1 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: No additive
• Immunogen: MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein.
• Protein Sequence: MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
• Tested applications: IHC-P, IP, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002412.1

Immunoperoxidase of purified MaxPab rabbit antibody to MMP1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Immunoprecipitation of MMP1 transfected lysate using anti-MMP1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MMP1 purified MaxPab mouse polyclonal antibody (B01P) (orb2292589).

MMP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of MMP1 expression in human pancreas.

Western Blot analysis of MMP1 expression in transfected 293T cell line by MMP1 MaxPab polyclonal antibody. Lane 1: MMP1 transfected lysate (54.00 KDa). Lane 2: Non-transfected lysate.