MLH1 Rabbit Polyclonal Antibody

SKU: orb582989

Description

Rabbit polyclonal antibody to MLH1

Research Area

Cancer Biology, Cell Biology, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLH1
• Target: MLH1
• Protein Sequence: Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK
• Molecular Weight: 84kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FCC2, COCA2, HNPCC, hMLH1, HNPCC2, MMRCS1

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: hMLH1 tranfected 293 cells, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: MLH1, MLH1 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-MLH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

MLH1

UniProt

P40692

RefSeq (Protein):NP_000240