Miraculin Protein, Synsepalum dulcificum, Recombinant (His)

• Catalog Number: orb1976304
• Category: Proteins
• Description: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P13087.
• Tag: N-6xHis
• Purity: 85.00%
• MW: 23.4 kDa (predicted)
• UniProt ID: P13087
• Protein Sequence: DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF
• Expression System: P. pastoris (Yeast)
• Biological Origin: Synsepalum dulcificum
• Biological Activity: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 23.4 kDa and the accession number is P13087.
• Expression Region: 30-220 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.