You have no items in your shopping cart.
Cart summary
Miraculin Protein, Synsepalum dulcificum, Recombinant (E. coli, His)
Catalog Number: orb1976305
| Catalog Number | orb1976305 |
|---|---|
| Category | Proteins |
| Description | Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is P13087. |
| Tag | N-10xHis |
| Purity | 98.00% |
| MW | 24.9 kDa (predicted) |
| UniProt ID | P13087 |
| Protein Sequence | DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF |
| Expression System | E. coli |
| Biological Origin | Synsepalum dulcificum |
| Biological Activity | Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Miraculin Protein, Synsepalum dulcificum, Recombinant (E. coli, His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 24.9 kDa and the accession number is P13087. |
| Expression Region | 30-220 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
