MIF4GD Rabbit Polyclonal Antibody

SKU: orb577844

Description

Rabbit polyclonal antibody to MIF4GD

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MIF4GD
• Target: MIF4GD
• Protein Sequence: Synthetic peptide located within the following region: LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
• Molecular Weight: 28kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

MIFD, AD023, SLIP1

Rabbit Anti-MIF4GD Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-MIF4GD Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

MIF4GD

UniProt

Q8N4Q5

RefSeq (Protein):NP_065730