MIF Rabbit Polyclonal Antibody

SKU: orb583119

Description

MIF Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of MIF. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human MIF. This antibody reacts with Human, Rat samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIF
• Target: MIF
• Protein Sequence: Synthetic peptide located within the following region: PQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLL
• Molecular Weight: 12kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GIF, GLIF, MMIF

Quick Database Links

Gene Symbol

MIF

UniProt

P14174

RefSeq (Protein):NP_002406