MGLL Rabbit Polyclonal Antibody

SKU: orb330677

Description

Rabbit polyclonal antibody to MGLL

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGLL
• Target: MGLL
• Protein Sequence: Synthetic peptide located within the following region: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGT
• Molecular Weight: 34kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti HU-K5 antibody, anti MGL antibody, anti HUK5 antibody, anti MAGL antibody

WB Suggested Anti-MGLL Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: ACHN cell lysate, MGLL is supported by BioGPS gene expression data to be expressed in ACHN.

Quick Database Links

Gene Symbol

MGLL

UniProt

Q6IBG9

RefSeq (Protein):NP_009214